Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Astyanax fasciatus Blue-sensitive opsin (B23)

This Recombinant Astyanax fasciatus Blue-sensitive opsin (B23) spans the amino acid sequence from region 1-355.

Product Specifications

Product Name Alternative

Blue-sensitive opsin, Blue cone photoreceptor pigment

UniProt

P51472

Expression Region

1-355

Origin

Astyanax fasciatus (Blind cave fish) (Astyanax mexicanus)

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSRPQEFQEDFYIPIPLDTNNITALSPFLVPQDHLGGSGIFMIMTVFMLFLFIGGTSIN VLTIVCTVQYKKLRSHLNYILVNLAISNLLVSTVGSFTAFVSFLNRYFIFGPTACKIEGF VATLGGMVSLWSLSVVAFERWLVICKPVGNFSFKGTHAIIGCALTWFFALLASTPPLFGW SRYIPEGLQCSCGPDWYTTENKYNNESYVMFLFCFCFGFPFTVILFCYGQLLFTLKSAAK AQADSASTQKAEREVTKMVVVMVMGFLVCWLPYASFALWVVFNRGQSFDLRLGTIPSCFS KASTVYNPVIYVFMNKQFRSCMMKLIFCGKSPFGDDEEASSSSQVTQVSSVGPEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-100 1x 100 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-500 1x 500 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL
BNC940177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
BNC041820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-500 1x 500 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calponin-1 (Smooth Muscle Marker) (rCNN1/832), CF647 conjugate, 0.1mg/mL
BNC471866-500 1x 500 µL

Calponin-1 (Smooth Muscle Marker) (rCNN1/832), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details