Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anolis carolinensis Blue-sensitive opsin

This Recombinant Anolis carolinensis Blue-sensitive opsin spans the amino acid sequence from region 1-355.

Product Specifications

Product Name Alternative

Blue-sensitive opsin, Blue photoreceptor pigment, RH2 opsin

UniProt

P51471

Expression Region

1-355

Origin

Anolis carolinensis (Green anole) (American chameleon)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGINFYVPLSNKTGLVRSPFEYPQYYLAEPWKYKVVCCYIFFLIFTGLPINILTLL VTFKHKKLRQPLNYILVNLAVADLFMACFGFTVTFYTAWNGYFIFGPIGCAIEGFFATLG GQVALWSLVVLAIERYIVVCKPMGNFRFSATHALMGISFTWFMSFSCAAPPLLGWSRYIP EGMQCSCGPDYYTLNPDYHNESYVLYMFGVHFVIPVVVIFFSYGRLICKVREAAAQQQES ASTQKAEREVTRMVILMVLGFLLAWTPYAMVAFWIFTNKGVDFSATLMSVPAFFSKSSSL YNPIIYVLMNKQFRNCMITTICCGKNPFGDEDVSSSVSQSKTEVSSVSSSQVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tomosyn (STXBP5) (NM_001127715) Human Over-expression Lysate
LC426872 20 µg

Tomosyn (STXBP5) (NM_001127715) Human Over-expression Lysate

Sign In for Pricing
View Details
AATOM™ 550 azide
70233-AAT 1 mg

AATOM™ 550 azide

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS708118 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
CD34 (QBEnd/10 + HPCA1/763), CF640R conjugate, 0.1mg/mL
BNC400904-100 1x 100 µL

CD34 (QBEnd/10 + HPCA1/763), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LIMS1 Human Gene Knockout Kit (CRISPR)
KN402765 1 Kit

LIMS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KCNIP4 Antibody
OC-2449-01 50 μL

KCNIP4 Antibody

Sign In for Pricing
View Details