Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anolis carolinensis Blue-sensitive opsin

This Recombinant Anolis carolinensis Blue-sensitive opsin spans the amino acid sequence from region 1-355.

Product Specifications

Product Name Alternative

Blue-sensitive opsin, Blue photoreceptor pigment, RH2 opsin

UniProt

P51471

Expression Region

1-355

Origin

Anolis carolinensis (Green anole) (American chameleon)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGINFYVPLSNKTGLVRSPFEYPQYYLAEPWKYKVVCCYIFFLIFTGLPINILTLL VTFKHKKLRQPLNYILVNLAVADLFMACFGFTVTFYTAWNGYFIFGPIGCAIEGFFATLG GQVALWSLVVLAIERYIVVCKPMGNFRFSATHALMGISFTWFMSFSCAAPPLLGWSRYIP EGMQCSCGPDYYTLNPDYHNESYVLYMFGVHFVIPVVVIFFSYGRLICKVREAAAQQQES ASTQKAEREVTRMVILMVLGFLLAWTPYAMVAFWIFTNKGVDFSATLMSVPAFFSKSSSL YNPIIYVLMNKQFRNCMITTICCGKNPFGDEDVSSSVSQSKTEVSSVSSSQVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF beta 2 (TGFB2) (NM_003238) Human Over-expression Lysate
LY401115 100 µg

TGF beta 2 (TGFB2) (NM_003238) Human Over-expression Lysate

Sign In for Pricing
View Details
CBLN1 Antibody
8C15056-AAT 50 µg

CBLN1 Antibody

Sign In for Pricing
View Details
STAT3 / Signal Transducer and Activator of Transcription 3 (PCRP-STAT3-2F12), CF647 conjugate, 0.1mg/mL
BNC471907-100 1x 100 µL

STAT3 / Signal Transducer and Activator of Transcription 3 (PCRP-STAT3-2F12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Uterus
CS805654 5x 5 µm

Tissue FFPE Sections, Uterus

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
BNC740043-100 1x 100 µL

P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-4 / ERBB4 (ERBB4/2581), Biotin conjugate, 0.1mg/mL
BNCB2581-100 1x 100 µL

HER-4 / ERBB4 (ERBB4/2581), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details