Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anolis carolinensis Blue-sensitive opsin

This Recombinant Anolis carolinensis Blue-sensitive opsin spans the amino acid sequence from region 1-355.

Product Specifications

Product Name Alternative

Blue-sensitive opsin, Blue photoreceptor pigment, RH2 opsin

UniProt

P51471

Expression Region

1-355

Origin

Anolis carolinensis (Green anole) (American chameleon)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGINFYVPLSNKTGLVRSPFEYPQYYLAEPWKYKVVCCYIFFLIFTGLPINILTLL VTFKHKKLRQPLNYILVNLAVADLFMACFGFTVTFYTAWNGYFIFGPIGCAIEGFFATLG GQVALWSLVVLAIERYIVVCKPMGNFRFSATHALMGISFTWFMSFSCAAPPLLGWSRYIP EGMQCSCGPDYYTLNPDYHNESYVLYMFGVHFVIPVVVIFFSYGRLICKVREAAAQQQES ASTQKAEREVTRMVILMVLGFLLAWTPYAMVAFWIFTNKGVDFSATLMSVPAFFSKSSSL YNPIIYVLMNKQFRNCMITTICCGKNPFGDEDVSSSVSQSKTEVSSVSSSQVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFIP11 Human Gene Knockout Kit (CRISPR)
KN400290 1 Kit

TFIP11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OTC Polyclonal Antibody
E-AB-15274-01 20 µL

OTC Polyclonal Antibody

Sign In for Pricing
View Details
OTC Polyclonal Antibody
E-AB-15274-02 60 µL

OTC Polyclonal Antibody

Sign In for Pricing
View Details
OTC Polyclonal Antibody
E-AB-15274-03 120 µL

OTC Polyclonal Antibody

Sign In for Pricing
View Details
OTC Polyclonal Antibody
E-AB-15274-04 200 µL

OTC Polyclonal Antibody

Sign In for Pricing
View Details
CDC42EP3 Human Gene Knockout Kit (CRISPR)
KN401069 1 Kit

CDC42EP3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details