Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb2601c (Mb2601c)

This Recombinant Uncharacterized protein Mb2601c (Mb2601c) spans the amino acid sequence from region 1-355.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb2601c

UniProt

P65016

Expression Region

1-355

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSASLLVRTACGGRAVAQRLRTVLWPITQTSVVAGLAWYLTHDVFNHPQAFFAPISAVVC MSATNVLRARRAQQMIVGVALGIVLGAGVHALLGSGPIAMGVVVFIALSVAVLCARGLVA QGLMFINQAAVSAVLVLVFASNGSVVFERLFDALVGGGLAIVFSILLFPPDPVVMLCSAR ADVLAAVRDILAELVNTVSDPTSAPPDWPMAAADRLHQQLNGLIEVRANAAMVARRAPRR WGVRSTVRDLDQQAVYLALLVSSVLHLARTIAGPGGDKLPTPVHAVLTDLAAGTGLADAD PTAANEHAAAARATASTLQSAACGSNEVVRADIVQACVTDLQRVIERPGPSGMSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RGS5 Protein, N-His
MBS1577302-01 0.1 mg

Recombinant Human RGS5 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RGS5 Protein, N-His
MBS1577302-02 1 mg

Recombinant Human RGS5 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RGS5 Protein, N-His
MBS1577302-03 5x 1 mg

Recombinant Human RGS5 Protein, N-His

Sign In for Pricing
View Details
ABCD4 Protein Vector (Human) (pPB-N-His)
PV060742 500 ng

ABCD4 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Lentiviral human ZNF878 shRNA (UAS) - Lentiviral human ZNF878 shRNA (UAS, GFP) (25)
GTR15088964 1 Vial

Lentiviral human ZNF878 shRNA (UAS) - Lentiviral human ZNF878 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
SLIT3 Antibody
CSB-PA021769LA01HU-01 50 µg

SLIT3 Antibody

Sign In for Pricing
View Details