Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G-protein coupled receptor 1 (GPR1)

This Recombinant Human G-protein coupled receptor 1 (GPR1) spans the amino acid sequence from region 1-355.

Product Specifications

Product Name Alternative

G-protein coupled receptor 1

UniProt

P46091

Expression Region

1-355

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVI WFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLN MFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVE FNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILI SSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLN PILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFRSF4 Mouse Monoclonal Antibody [Clone ID: Ber-ACT35]
AM26798RP-N 100 Tests

TNFRSF4 Mouse Monoclonal Antibody [Clone ID: Ber-ACT35]

Sign In for Pricing
View Details
Moesin (rMSN/492), CF640R conjugate, 0.1mg/mL
BNC402307-500 1x 500 µL

Moesin (rMSN/492), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
gox Rabbit Polyclonal Antibody
TA396930 100 µg

gox Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ELOA3P activation kit by CRISPRa
GA116058 1 Kit

Human ELOA3P activation kit by CRISPRa

Sign In for Pricing
View Details
PIM3 (NM_001001852) Human Over-expression Lysate
LC424253 20 µg

PIM3 (NM_001001852) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD41 Antibody[HIP8]
E-AB-F1088M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD41 Antibody[HIP8]

Sign In for Pricing
View Details