Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G-protein coupled receptor 1 (GPR1)

This Recombinant Human G-protein coupled receptor 1 (GPR1) spans the amino acid sequence from region 1-355.

Product Specifications

Product Name Alternative

G-protein coupled receptor 1

UniProt

P46091

Expression Region

1-355

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVI WFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLN MFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVE FNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILI SSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLN PILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse PGF2α (Prostaglandin F2 Alpha) ELISA Kit
E-EL-M1360-01 24 Tests

Mouse PGF2α (Prostaglandin F2 Alpha) ELISA Kit

Sign In for Pricing
View Details
Mouse PGF2α (Prostaglandin F2 Alpha) ELISA Kit
E-EL-M1360-02 48 Tests

Mouse PGF2α (Prostaglandin F2 Alpha) ELISA Kit

Sign In for Pricing
View Details
Mouse PGF2α (Prostaglandin F2 Alpha) ELISA Kit
E-EL-M1360-03 96 Tests

Mouse PGF2α (Prostaglandin F2 Alpha) ELISA Kit

Sign In for Pricing
View Details
Tip Combs
KF-COMB-96-N 100 Units/Case

Tip Combs

Sign In for Pricing
View Details
Sulfotransferase 2A1 Antibody
KC-49199-01 50 μL

Sulfotransferase 2A1 Antibody

Sign In for Pricing
View Details
Sulfotransferase 2A1 Antibody
KC-49199-02 100 µL

Sulfotransferase 2A1 Antibody

Sign In for Pricing
View Details