Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G-protein coupled receptor 1 (GPR1)

This Recombinant Human G-protein coupled receptor 1 (GPR1) spans the amino acid sequence from region 1-355.

Product Specifications

Product Name Alternative

G-protein coupled receptor 1

UniProt

P46091

Expression Region

1-355

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVI WFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLN MFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVE FNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILI SSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLN PILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALE (NM_000403) Human Recombinant Protein
TP720236L 500 µg

GALE (NM_000403) Human Recombinant Protein

Sign In for Pricing
View Details
SETBP1 Human Gene Knockout Kit (CRISPR)
KN417026 1 Kit

SETBP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat ACV-A Antibody Pair Set
E-KAB-0649 50 µL & 100 µg

Rat ACV-A Antibody Pair Set

Sign In for Pricing
View Details
Mouse Dhx36 activation kit by CRISPRa
GA209134 1 Kit

Mouse Dhx36 activation kit by CRISPRa

Sign In for Pricing
View Details
Cldn2 Mouse Gene Knockout Kit (CRISPR)
KN503411 1 Kit

Cldn2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF568 conjugate, 0.1mg/mL
BNC681731-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details