Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Green-sensitive opsin (PRA1)

This Recombinant Chicken Green-sensitive opsin (PRA1) spans the amino acid sequence from region 1-355.

Product Specifications

Product Name Alternative

Green-sensitive opsin, Green cone photoreceptor pigment

UniProt

P28683

Expression Region

1-355

Origin

Gallus gallus (Chicken)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGINFYVPMSNKTGVVRSPFEYPQYYLAEPWKYRLVCCYIFFLISTGLPINLLTLL VTFKHKKLRQPLNYILVNLAVADLFMACFGFTVTFYTAWNGYFVFGPVGCAVEGFFATLG GQVALWSLVVLAIERYIVVCKPMGNFRFSATHAMMGIAFTWVMAFSCAAPPLFGWSRYMP EGMQCSCGPDYYTHNPDYHNESYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQES ATTQKAEKEVTRMVILMVLGFMLAWTPYAVVAFWIFTNKGADFTATLMAVPAFFSKSSSL YNPIIYVLMNKQFRNCMITTICCGKNPFGDEDVSSTVSQSKTEVSSVSSSQVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHC2 Antibody
8C18733-AAT 50 µg

SHC2 Antibody

Sign In for Pricing
View Details
Human Kappa Light Chain (HP6053 + L1C1), Biotin conjugate, 0.1mg/mL
BNCB0755-100 1x 100 µL

Human Kappa Light Chain (HP6053 + L1C1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TPSD1 Rabbit Polyclonal Antibody
TA385453 100 µL

TPSD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Acetylcholinesterase Recombinant Rabbit monoclonal Antibody
HA723219 100 µL

Acetylcholinesterase Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PP2A-beta (PPP2CB) Rabbit Monoclonal Antibody
TA422547 100 µL

PP2A-beta (PPP2CB) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CD45RB (PD7/26), CF740 conjugate, 0.1mg/mL
BNC740472-100 1x 100 µL

CD45RB (PD7/26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details