Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Green-sensitive opsin (PRA1)

This Recombinant Chicken Green-sensitive opsin (PRA1) spans the amino acid sequence from region 1-355.

Product Specifications

Product Name Alternative

Green-sensitive opsin, Green cone photoreceptor pigment

UniProt

P28683

Expression Region

1-355

Origin

Gallus gallus (Chicken)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGINFYVPMSNKTGVVRSPFEYPQYYLAEPWKYRLVCCYIFFLISTGLPINLLTLL VTFKHKKLRQPLNYILVNLAVADLFMACFGFTVTFYTAWNGYFVFGPVGCAVEGFFATLG GQVALWSLVVLAIERYIVVCKPMGNFRFSATHAMMGIAFTWVMAFSCAAPPLFGWSRYMP EGMQCSCGPDYYTHNPDYHNESYVLYMFVIHFIIPVVVIFFSYGRLICKVREAAAQQQES ATTQKAEKEVTRMVILMVLGFMLAWTPYAVVAFWIFTNKGADFTATLMAVPAFFSKSSSL YNPIIYVLMNKQFRNCMITTICCGKNPFGDEDVSSTVSQSKTEVSSVSSSQVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyridoxal 5'-Phosphate-d3 (>85%)
TRC-H605892-2.5MG 2.5 mg

Pyridoxal 5'-Phosphate-d3 (>85%)

Sign In for Pricing
View Details
CD272 (BTLA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F5]
TA505686BM 100 µL

CD272 (BTLA) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F5]

Sign In for Pricing
View Details
Eph receptor A2 (EPHA2) Human Gene Knockout Kit (CRISPR)
KN205725 1 Kit

Eph receptor A2 (EPHA2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (B22.1), CF647 conjugate, 0.1mg/mL
BNC471266-100 1x 100 µL

Cytokeratin 8 (KRT8) (B22.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HDAC6 Antibody
KC-6139-01 50 μL

HDAC6 Antibody

Sign In for Pricing
View Details
HDAC6 Antibody
KC-6139-02 100 µL

HDAC6 Antibody

Sign In for Pricing
View Details