Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gecko gecko Blue-sensitive opsin P467

This Recombinant Gecko gecko Blue-sensitive opsin P467 spans the amino acid sequence from region 1-355.

Product Specifications

Product Name Alternative

Blue-sensitive opsin P467, Blue photoreceptor pigment

UniProt

P35357

Expression Region

1-355

Origin

Gecko gecko (Tokay gecko)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGINFYVPLSNKTGLVRSPFEYPQYYLADPWKFKVLSFYMFFLIAAGMPLNGLTLF VTFQHKKLRQPLNYILVNLAAANLVTVCCGFTVTFYASWYAYFVFGPIGCAIEGFFATIG GQVALWSLVVLAIERYIVICKPMGNFRFSATHAIMGIAFTWFMALACAGPPLFGWSRFIP EGMQCSCGPDYYTLNPDFHNESYVIYMFIVHFTVPMVVIFFSYGRLVCKVREAAAQQQES ATTQKAEKEVTRMVILMVLGFLLAWTPYAATAIWIFTNRGAAFSVTFMTIPAFFSKSSSI YNPIIYVLLNKQFRNCMVTTICCGKNPFGDEDVSSSVSQSKTEVSSVSSSQVAPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTGFR Polyclonal antibody
bs-10433R-01 20 µL

PTGFR Polyclonal antibody

Sign In for Pricing
View Details
PTGFR Polyclonal antibody
bs-10433R-02 100 µL

PTGFR Polyclonal antibody

Sign In for Pricing
View Details
Human IgA1 Monoclonal Antibody, HRP
E55A11306 100 µL

Human IgA1 Monoclonal Antibody, HRP

Sign In for Pricing
View Details
ZNF807P sgRNA CRISPR Lentivector (Human) (Target 2)
K2734803 1.0 µg DNA

ZNF807P sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
TRIM32 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
47770154 3x 1.0 µg DNA

TRIM32 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) IPP1 Polyclonal Antibody
MBS7141306 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) IPP1 Polyclonal Antibody

Sign In for Pricing
View Details