Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gecko gecko Blue-sensitive opsin P467

This Recombinant Gecko gecko Blue-sensitive opsin P467 spans the amino acid sequence from region 1-355.

Product Specifications

Product Name Alternative

Blue-sensitive opsin P467, Blue photoreceptor pigment

UniProt

P35357

Expression Region

1-355

Origin

Gecko gecko (Tokay gecko)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGTEGINFYVPLSNKTGLVRSPFEYPQYYLADPWKFKVLSFYMFFLIAAGMPLNGLTLF VTFQHKKLRQPLNYILVNLAAANLVTVCCGFTVTFYASWYAYFVFGPIGCAIEGFFATIG GQVALWSLVVLAIERYIVICKPMGNFRFSATHAIMGIAFTWFMALACAGPPLFGWSRFIP EGMQCSCGPDYYTLNPDFHNESYVIYMFIVHFTVPMVVIFFSYGRLVCKVREAAAQQQES ATTQKAEKEVTRMVILMVLGFLLAWTPYAATAIWIFTNRGAAFSVTFMTIPAFFSKSSSI YNPIIYVLLNKQFRNCMVTTICCGKNPFGDEDVSSSVSQSKTEVSSVSSSQVAPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELL Peptide
orb2021675 100 µg

ELL Peptide

Sign In for Pricing
View Details
Mago nashi homolog 2 (MAGOHB) (NM_018048) Human Over-expression Lysate
LC413358 20 µg

Mago nashi homolog 2 (MAGOHB) (NM_018048) Human Over-expression Lysate

Sign In for Pricing
View Details
MTX1 Antibody Blocking Peptide
orb1509696 500 µg

MTX1 Antibody Blocking Peptide

Sign In for Pricing
View Details
NOS2 ELISA Kit (Mouse)
OKCD06882-96W 96 Well

NOS2 ELISA Kit (Mouse)

Sign In for Pricing
View Details
BMX Antibody
A11500-100UG 100 µg

BMX Antibody

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD161 Antibody[HP-3G10]
E-AB-F1155I-01 20 Tests

PE/Cyanine5.5 Anti-Human CD161 Antibody[HP-3G10]

Sign In for Pricing
View Details