Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class epsilon-29 (sre-29)

This Recombinant Serpentine receptor class epsilon-29 (sre-29) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Serpentine receptor class epsilon-29, Protein sre-29

UniProt

O62269

Expression Region

1-356

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIKINSNDIWLPIHFYDETFNFQLVLSIVELFSYLICAYILTLNIYIILKIKMFHRNLY ILAIPLFGIWFELIIGKLITIAYRLKILNPGFELGVHIEIWTSDPTRKLKVESVNGLELL IFGGFLQWHYMFTIIFGVLAIAVERVVASVLIENYESNTQLFIPLFLTVISQFLSISTSL ALLFQKVGPFLAQLPWIICCPFSAMAYFFVKKCNESFEREIRNPRRRRHFSVSQQFQVKE NLRALYLGTRLVFVVLSCIALCGIGITALFYDLIPPFCCHFVENFLFLHPYLSCLTAIFS VPQWKNEFREVSVLGRCLKIGRLKIESENAMEIQDSTKKMGTETDLYFQQLADSWI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SREBP1 Recombinant Rabbit monoclonal Antibody
HA750968 100 µL

SREBP1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS622139 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
2-[(2-Hydroxyethyl)octadecylamino]ethyl ester octadecanoic acid
TRC-H998250-100MG 100 mg

2-[(2-Hydroxyethyl)octadecylamino]ethyl ester octadecanoic acid

Sign In for Pricing
View Details
Avocadyne-d6 (racemic, mix of diastereomers)
TRC-A794909-50MG 50 mg

Avocadyne-d6 (racemic, mix of diastereomers)

Sign In for Pricing
View Details
ATP2B4 Antibody
KC-19808-01 50 μL

ATP2B4 Antibody

Sign In for Pricing
View Details
ATP2B4 Antibody
KC-19808-02 100 µL

ATP2B4 Antibody

Sign In for Pricing
View Details