Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class epsilon-29 (sre-29)

This Recombinant Serpentine receptor class epsilon-29 (sre-29) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Serpentine receptor class epsilon-29, Protein sre-29

UniProt

O62269

Expression Region

1-356

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIKINSNDIWLPIHFYDETFNFQLVLSIVELFSYLICAYILTLNIYIILKIKMFHRNLY ILAIPLFGIWFELIIGKLITIAYRLKILNPGFELGVHIEIWTSDPTRKLKVESVNGLELL IFGGFLQWHYMFTIIFGVLAIAVERVVASVLIENYESNTQLFIPLFLTVISQFLSISTSL ALLFQKVGPFLAQLPWIICCPFSAMAYFFVKKCNESFEREIRNPRRRRHFSVSQQFQVKE NLRALYLGTRLVFVVLSCIALCGIGITALFYDLIPPFCCHFVENFLFLHPYLSCLTAIFS VPQWKNEFREVSVLGRCLKIGRLKIESENAMEIQDSTKKMGTETDLYFQQLADSWI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGC114440 Protein Vector (Rat) (pPM-C-HA)
28495026 500 ng

MGC114440 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
REN Antibody
CSB-PA019561GA01HU 100 µL

REN Antibody

Sign In for Pricing
View Details
C15orf38 (ARPIN) (NM_182616) Human Over-expression Lysate
E45H15923-2 20 µg

C15orf38 (ARPIN) (NM_182616) Human Over-expression Lysate

Sign In for Pricing
View Details
FOXO1A (Forkhead Box O1, FKH1, FKHR, FOXO1A) (MaxLight 550)
246313-ML550 100 µL

FOXO1A (Forkhead Box O1, FKH1, FKHR, FOXO1A) (MaxLight 550)

Sign In for Pricing
View Details
Anti-Adiponectin Receptor 1/ADIPOR1 Antibody Picoband® (Dylight488 Conjugate)
PB9418-Dylight488 100 µg

Anti-Adiponectin Receptor 1/ADIPOR1 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Hey L (HEYL) (NM_014571) Human Over-expression Lysate
LS026508-20ug 20 µg

Hey L (HEYL) (NM_014571) Human Over-expression Lysate

Sign In for Pricing
View Details