Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class epsilon-29 (sre-29)

This Recombinant Serpentine receptor class epsilon-29 (sre-29) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Serpentine receptor class epsilon-29, Protein sre-29

UniProt

O62269

Expression Region

1-356

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIKINSNDIWLPIHFYDETFNFQLVLSIVELFSYLICAYILTLNIYIILKIKMFHRNLY ILAIPLFGIWFELIIGKLITIAYRLKILNPGFELGVHIEIWTSDPTRKLKVESVNGLELL IFGGFLQWHYMFTIIFGVLAIAVERVVASVLIENYESNTQLFIPLFLTVISQFLSISTSL ALLFQKVGPFLAQLPWIICCPFSAMAYFFVKKCNESFEREIRNPRRRRHFSVSQQFQVKE NLRALYLGTRLVFVVLSCIALCGIGITALFYDLIPPFCCHFVENFLFLHPYLSCLTAIFS VPQWKNEFREVSVLGRCLKIGRLKIESENAMEIQDSTKKMGTETDLYFQQLADSWI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF507 Antibody - middle region : FITC (ARP35888_P050-FITC)
ARP35888_P050-FITC 100 µL

ZNF507 Antibody - middle region : FITC (ARP35888_P050-FITC)

Sign In for Pricing
View Details
Multispecies SAA ELISA Control Set
TP-802-CON 2x 1 mL

Multispecies SAA ELISA Control Set

Sign In for Pricing
View Details
Chrna5 (NM_176844) Mouse Tagged ORF Clone
MR225729 10 µg

Chrna5 (NM_176844) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
HnRNP G Antibody
E38PA4195 100 µL

HnRNP G Antibody

Sign In for Pricing
View Details
Anti-GJC2 Antibody Picoband® (iFluor647 Conjugate)
PB9706-iFluor647 100 µg

Anti-GJC2 Antibody Picoband® (iFluor647 Conjugate)

Sign In for Pricing
View Details
Transport tube with conical bottom/self-standing, PP material, VOL.10ml/16X94mm, with frosted writingn area and molded graduation at every 1ml up to 10ml, cap in PE material, Non-sterilized.
PLAC4004X1580NS 1000 Pieces/Case:100 Pieces/ PACKS:10 PACKS/CASE

Transport tube with conical bottom/self-standing, PP material, VOL.10ml/16X94mm, with frosted writingn area and molded graduation at every 1ml up to 10ml, cap in PE material, Non-sterilized.

Sign In for Pricing
View Details