Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhomboid-related protein 1 (rom-1)

This Recombinant Rhomboid-related protein 1 (rom-1) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Rhomboid-related protein 1, EC= 3.4.21.105

UniProt

Q19821

Expression Region

1-356

Origin

Caenorhabditis elegans

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSSEGKFRKTYRHQFNQLRTGDETEIPMSTLASRIETRKIPLTNGQIHAIKEAPDELVD IDGFQKIVTSKAAQRSTIKRIMYDMADPIMSDSQKIEVHSYIDSYSWCPPPIFMLLITII QVGIFFFYWESDGGRSIWTDCAGCFVHHNHTAPGIFIFAPKLRGEAWRFTSYMFLHAGLN HLLGNVIIQLLVGIPLEVAHKIWRIGPIYLLAVTSGSLLQYAIDPNSLLVGASAGVYALI FAHVANVILNWHEMPLRWIRVLVLFVFIFLDFGGAIHRRFYTNDCDSVSHLAHIAGAVTG LFFGYVVLYNVVEHRIEKIIRYVCLFLYSAFFATTIIFVIVRQPYSKNLWNNENCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF12 Antibody Blocking peptide
orb1447583 500 µg

FGF12 Antibody Blocking peptide

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Protein GMH1 (GMH1)
orb2916477-01 20 µg

Recombinant Saccharomyces cerevisiae Protein GMH1 (GMH1)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Protein GMH1 (GMH1)
orb2916477-02 100 µg

Recombinant Saccharomyces cerevisiae Protein GMH1 (GMH1)

Sign In for Pricing
View Details
Goose Proline-Rich Protein 16 (PRR16) ELISA Kit
MBS9934795 Inquire

Goose Proline-Rich Protein 16 (PRR16) ELISA Kit

Sign In for Pricing
View Details
TNFSF9 (Tumor necrosis factor ligand superfamily member 9) (Biotin)
338543-01 50 µg

TNFSF9 (Tumor necrosis factor ligand superfamily member 9) (Biotin)

Sign In for Pricing
View Details
TNFSF9 (Tumor necrosis factor ligand superfamily member 9) (Biotin)
338543-02 100 µg

TNFSF9 (Tumor necrosis factor ligand superfamily member 9) (Biotin)

Sign In for Pricing
View Details