Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit CX3C chemokine receptor 1 (CX3CR1)

This Recombinant Rabbit CX3C chemokine receptor 1 (CX3CR1) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

CX3C chemokine receptor 1, C-X3-C CKR-1, CX3CR1, Fractalkine receptor

UniProt

Q2KTE1

Expression Region

1-356

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTLYSDWATESFEYDESSEACFIGDIVAFGTIFLSIFYSLVFAFGLVGNLLVVCALTSS RKPKSITDIYLLNLALSDLLFVATLPFWTHYVISEQGFHNAVCKLTTALFFIGFFGGIFF ITVISIDRYMAIVLAANSINNRTVQHGVTTSLGVWAAAILVAAPQFMFTKQKGNECLGDY PEVLQDIWPVLRNTEANFLGFLLPVLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIV FFLFWTPYNVMIFLETLKLYGFFPNCDMKRDLRLALSVTETVAFSHCCLNPLIYAFAGQK FRRYLRHLSRKCQAVLCGRPVHVSFSPSESQRSRQESIVSSNFTHYTSDGDASLLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL
BNC741045-100 1x 100 µL

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF488A conjugate, 0.1mg/mL
BNC880345-500 1x 500 µL

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-500 1x 500 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
BNC470181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMACR / p504S (Rabbit PAb), CF647 conjugate, 0.1mg/mL
BNC470731-100 1x 100 µL

AMACR / p504S (Rabbit PAb), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF647 conjugate, 0.1mg/mL
BNC472886-500 1x 500 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details