Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa subsp. japonica Phosphoenolpyruvate/phosphate translocator 2, chloroplastic (PPT2)

This Recombinant Oryza sativa subsp. japonica Phosphoenolpyruvate/phosphate translocator 2, chloroplastic (PPT2) spans the amino acid sequence from region 52-407.

Product Specifications

Product Name Alternative

Phosphoenolpyruvate/phosphate translocator 2, chloroplastic, OsPPT2

UniProt

Q84QU8

Expression Region

52-407

Origin

Oryza sativa subsp. japonica (Rice)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AVAARSLGRLLLLPPPPPISPDRAGRGRARHVACGAAAGDAKAEEEESGLAKTLQLGALF GLWYLFNIYFNIYNKQVLKVFPYPINITTVQFAVGTVVALFMWITGILRRPKISGAQLFA ILPLAVVHTMGNLFTNMSLGKVAVSFTHTIKAMEPFFSVLLSAIFLGELPTVWVILSLLP IVGGVALASLTEASFNWAGFWSAMASNVTFQSRNVLSKKLMVKKEESLDNINLFSIITVM SFFLLAPVAFLTEGIKITPTVLQSAGLNVKQVLTRSLLAALCFHAYQQVSYMILARVSPV THSVGNCVKRVVVIVTSVLFFRTPVSPINSLGTAIALAGVFLYSQLKRLKPKPKAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
BNC400043-500 1x 500 µL

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF488A conjugate, 0.1mg/mL
BNC880851-100 1x 100 µL

HSP60 (LK1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-100 1x 100 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-500 1x 500 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF405S conjugate, 0.1mg/mL
BNC040032-500 1x 500 µL

MUC2 (CCP58), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (NX2.1/690), CF740 conjugate, 0.1mg/mL
BNC740690-500 1x 500 µL

TTF-1 / NKX2.1 (NX2.1/690), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details