Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable G-protein coupled receptor 32 (GPR32)

This Recombinant Human Probable G-protein coupled receptor 32 (GPR32) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 32

UniProt

O75388

Expression Region

1-356

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGVSEGTRGCSDRQPGVLTRDRSCSRKMNSSGCLSEEVGSLRPLTVVILSASIVVGVLG NGLVLWMTVFRMARTVSTVCFFHLALADFMLSLSLPIAMYYIVSRQWLLGEWACKLYITF VFLSYFASNCLLVFISVDRCISVLYPVWALNHRTVQRASWLAFGVWLLAAALCSAHLKFR TTRKWNGCTHCYLAFNSDNETAQIWIEGVVEGHIIGTIGHFLLGFLGPLAIIGTCAHLIR AKLLREGWVHANRPKRLLLVLVSAFFIFWSPFNVVLLVHLWRRVMLKEIYHPRMLLILQA SFALGCVNSSLNPFLYVFVGRDFQEKFFQSLTSALARAFGEEEFLSSCPRGNAPRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Artemin (ARTN) (NM_057091) Human Tagged Lenti ORF Clone
RC215471L4 10 µg

Artemin (ARTN) (NM_057091) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CTSC Antibody
MBS7128679-01 0.05 mL

CTSC Antibody

Sign In for Pricing
View Details
CTSC Antibody
MBS7128679-02 0.1 mL

CTSC Antibody

Sign In for Pricing
View Details
CTSC Antibody
MBS7128679-03 5x 0.1 mL

CTSC Antibody

Sign In for Pricing
View Details
CPS1 Human Over-expression Lysate
orb1361562 20 µg

CPS1 Human Over-expression Lysate

Sign In for Pricing
View Details
Fibrillarin Antibody
orb1532965 100 µL

Fibrillarin Antibody

Sign In for Pricing
View Details