Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable G-protein coupled receptor 32 (GPR32)

This Recombinant Human Probable G-protein coupled receptor 32 (GPR32) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 32

UniProt

O75388

Expression Region

1-356

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGVSEGTRGCSDRQPGVLTRDRSCSRKMNSSGCLSEEVGSLRPLTVVILSASIVVGVLG NGLVLWMTVFRMARTVSTVCFFHLALADFMLSLSLPIAMYYIVSRQWLLGEWACKLYITF VFLSYFASNCLLVFISVDRCISVLYPVWALNHRTVQRASWLAFGVWLLAAALCSAHLKFR TTRKWNGCTHCYLAFNSDNETAQIWIEGVVEGHIIGTIGHFLLGFLGPLAIIGTCAHLIR AKLLREGWVHANRPKRLLLVLVSAFFIFWSPFNVVLLVHLWRRVMLKEIYHPRMLLILQA SFALGCVNSSLNPFLYVFVGRDFQEKFFQSLTSALARAFGEEEFLSSCPRGNAPRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXM1 (G-5) Alexa Fluor® 488
sc-376471 AF488 200 µg/mL

FOXM1 (G-5) Alexa Fluor® 488

Sign In for Pricing
View Details
Human Bruton tyrosine kinase, Btk ELISA Kit
CK-bio-10657-01 48 Tests

Human Bruton tyrosine kinase, Btk ELISA Kit

Sign In for Pricing
View Details
Human Bruton tyrosine kinase, Btk ELISA Kit
CK-bio-10657-02 96 Tests

Human Bruton tyrosine kinase, Btk ELISA Kit

Sign In for Pricing
View Details
Human Bruton tyrosine kinase, Btk ELISA Kit
CK-bio-10657-03 5x 96 Tests

Human Bruton tyrosine kinase, Btk ELISA Kit

Sign In for Pricing
View Details
Human Bruton tyrosine kinase, Btk ELISA Kit
CK-bio-10657-04 10x 96 Tests

Human Bruton tyrosine kinase, Btk ELISA Kit

Sign In for Pricing
View Details
Rat Myosin Heavy Chain 7, Cardiac Muscle, Beta (MYH7) ELISA Kit
DLR-MYH7-Ra-01 48 Tests

Rat Myosin Heavy Chain 7, Cardiac Muscle, Beta (MYH7) ELISA Kit

Sign In for Pricing
View Details