Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog C-X-C chemokine receptor type 2 (CXCR2)

This Recombinant Dog C-X-C chemokine receptor type 2 (CXCR2) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

C-X-C chemokine receptor type 2, CXC-R2, CXCR-2, GRO/MGSA receptor, High affinity interleukin-8 receptor B, IL-8R B, CD_antigen= CD182

UniProt

O97571

Expression Region

1-356

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEYINWDNYSLEDLFGDIDNYTYNTEMPIIPADSAPCRPESLDINKYAVVVIYVLVFVLN LLGNSLVIMVVLYSRVSHSVTDVYLLNLAIADLLFALTLPIWAVSKVKGWIFGTPLCKIV SLLKEVNFYSGILLLASISMDRYLAIVHATRRLTQKKHWVKFICLGIWALSLILSLPIFV FRRAINPPYSSPVCYEDMGTNTTKLRIVMRALPQTFGFIVPLMIMLFCYGLTLRTLFEAH MGQKHRAMRVIFAVVLVFLLCWLPYNLVADTLMRLQAIEETCQRRNDIGRALDATEILGF FHSCLNPLIYAFIGQKFRHGLLKIMAFHGLISKEYLPKDSRPSFVGSSSANTSTTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF568 conjugate, 0.1mg/mL
BNC680012-100 1x 100 µL

Tyrosinase (T311), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
BNC881073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
BNC740304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (KRT18/2819R), CF405S conjugate, 0.1mg/mL
BNC042819-100 1x 100 µL

Cytokeratin 18 (KRT18) (KRT18/2819R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (PHE5), CF594 conjugate, 0.1mg/mL
BNC940461-100 1x 100 µL

Chromogranin A (PHE5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
B7-H4 (Immuno-Inhibitory Protein) (B7H4/2652R), CF647 conjugate, 0.1mg/mL
BNC472652-100 1x 100 µL

B7-H4 (Immuno-Inhibitory Protein) (B7H4/2652R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details