Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Prostaglandin D2 receptor-like (Ptgdrl)

This Recombinant Rat Prostaglandin D2 receptor-like (Ptgdrl) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

Prostaglandin D2 receptor-like, PGD receptor-like, PGD2 receptor-like, Prostanoid DP receptor-like

UniProt

O35932

Expression Region

1-357

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNESYRCQAATWVERGSSATMGGVLFSAGLLGNLLALVLLARSGLGSCRPGPLHPPPSVF YVLVCGLTVTHLLGKCLISPMVLAAYAQNRSLKELLPASGNQLCEAFAFLMSFFGLASTL QLLAMALECWLSLGHPFFYQRHITARRGVLVAPVAGAFSLAFCALPFAGFGKFVQYCPGT WCFIQMIHKKRSFSVIGFSVLYSSLMALLVLATVVCNLGAMSNLYAMHRRQRHHPRRCSR DRAQSGSDYRHGSPNPLEELDHFVLLALTTVLFTMCSLPLIYRAYYGAFKLVDRADGDSE DLQALRFLSVISIVDPWIFIIFRTSVFRMLFHKAFTRPLIYRNWCSHSWQTNMESTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF740 conjugate, 0.1mg/mL
BNC740151-500 1x 500 µL

CD11a (Cris-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
BNC680266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF740 conjugate, 0.1mg/mL
BNC740193-500 1x 500 µL

CD86 (BU63), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL
BNC940633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL
BNC880304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
BNC940225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details