Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class epsilon-30 (sre-30)

This Recombinant Serpentine receptor class epsilon-30 (sre-30) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

Serpentine receptor class epsilon-30, Protein sre-30

UniProt

O62267

Expression Region

1-357

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIIHISNSSSYIWLSVYFYKEPLSLKLLISIFELSSCILCGYILNLSIFVMLKIQLFHKN LMFLTVPLFAIWHELIIGKFITIAYRLKIVNPGFELGEHTVFWTNDPDKTLEVAGSSGLE LLIFGGFLQWHTIYSIVFGILAVATERTIASVYIKDYESKERIYIPIILTIISQLLSISI SLAIITQSIGPFLARLPFVICAPLSVLVFLFIKHTNQSLLKEICNPKRTRIFTVSQQCQV KENLRALRLGTRLVVVVIFYISICGFGIAALTFGLIPAGFGHLIENFLFLHPYPICLTAM FSIPQWRDQFKKSILPFLNRRLAKIEQVVTVRIEVNVQNSSSVETDIYFRQLTESWT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYO19, ID (MYO19, MYOHD1, Unconventional myosin-XIX, Myosin head domain-containing protein 1) (MaxLight 750)
MBS6323427-01 0.1 mL

MYO19, ID (MYO19, MYOHD1, Unconventional myosin-XIX, Myosin head domain-containing protein 1) (MaxLight 750)

Sign In for Pricing
View Details
MYO19, ID (MYO19, MYOHD1, Unconventional myosin-XIX, Myosin head domain-containing protein 1) (MaxLight 750)
MBS6323427-02 5x 0.1 mL

MYO19, ID (MYO19, MYOHD1, Unconventional myosin-XIX, Myosin head domain-containing protein 1) (MaxLight 750)

Sign In for Pricing
View Details
Mouse IFN gamma Recombinant Protein
R00393-8 5 µg

Mouse IFN gamma Recombinant Protein

Sign In for Pricing
View Details
Recombinant Equine herpesvirus 1 DNA helicase/primase complex protein (7), partial
MBS1023139 Inquire

Recombinant Equine herpesvirus 1 DNA helicase/primase complex protein (7), partial

Sign In for Pricing
View Details
Lucidenic acid A
MBS5760598 Inquire

Lucidenic acid A

Sign In for Pricing
View Details
LINC01879 Human qPCR Primer Pair (NM_207461)
HP219759 200 Reactions

LINC01879 Human qPCR Primer Pair (NM_207461)

Sign In for Pricing
View Details