Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class epsilon-30 (sre-30)

This Recombinant Serpentine receptor class epsilon-30 (sre-30) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

Serpentine receptor class epsilon-30, Protein sre-30

UniProt

O62267

Expression Region

1-357

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIIHISNSSSYIWLSVYFYKEPLSLKLLISIFELSSCILCGYILNLSIFVMLKIQLFHKN LMFLTVPLFAIWHELIIGKFITIAYRLKIVNPGFELGEHTVFWTNDPDKTLEVAGSSGLE LLIFGGFLQWHTIYSIVFGILAVATERTIASVYIKDYESKERIYIPIILTIISQLLSISI SLAIITQSIGPFLARLPFVICAPLSVLVFLFIKHTNQSLLKEICNPKRTRIFTVSQQCQV KENLRALRLGTRLVVVVIFYISICGFGIAALTFGLIPAGFGHLIENFLFLHPYPICLTAM FSIPQWRDQFKKSILPFLNRRLAKIEQVVTVRIEVNVQNSSSVETDIYFRQLTESWT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human WDR87 ELISA Kit
E040562 1 Each

Human WDR87 ELISA Kit

Sign In for Pricing
View Details
MGluR5 Recombinant Antibody, FITC Conjugated
bsm-61218R-FITC-TR 20 µL

MGluR5 Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
Human PHC3 knockout cell line
ABC-KH11479 1 Vial

Human PHC3 knockout cell line

Sign In for Pricing
View Details
Mouse Interleukin 28A (IL28A) ELISA Kit
RD-IL28A-Mu-48Tests 48 Tests

Mouse Interleukin 28A (IL28A) ELISA Kit

Sign In for Pricing
View Details
PAK5 Polyclonal Antibody, Cy5.5 Conjugated
bs-24381R-Cy5.5 100 µL

PAK5 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Kaempferol 3-O-β-D-galactopyranoside
HY-N6605-01 1 mg

Kaempferol 3-O-β-D-galactopyranoside

Sign In for Pricing
View Details