Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes C-X-C chemokine receptor type 2 (CXCR2)

This Recombinant Pan troglodytes C-X-C chemokine receptor type 2 (CXCR2) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

C-X-C chemokine receptor type 2, CXC-R2, CXCR-2, High affinity interleukin-8 receptor B, IL-8R B, CD_antigen= CD182

UniProt

Q28807

Expression Region

1-357

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFLLSL LGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVS LLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPVLLF RRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFKAHM GQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATEILG ILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF405S conjugate, 0.1mg/mL
BNC040333-100 1x 100 µL

CD8 (RIV11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
BNC472853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (DO-7), CF405S conjugate, 0.1mg/mL
BNC040513-500 1x 500 µL

P53 (DO-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NGFR (Nerve Growth Factor Receptor) (NGFR5 + NTR/912), CF405S conjugate, 0.1mg/mL
BNC040914-500 1x 500 µL

NGFR (Nerve Growth Factor Receptor) (NGFR5 + NTR/912), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF568 conjugate, 0.1mg/mL
BNC681880-500 1x 500 µL

Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details