Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 183 (Gpr183)

This Recombinant Mouse G-protein coupled receptor 183 (Gpr183) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

G-protein coupled receptor 183, Epstein-Barr virus-induced G-protein coupled receptor 2, EBI2, EBV-induced G-protein coupled receptor 2

UniProt

Q3U6B2

Expression Region

1-357

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANNFTTPLATSHGNNCDLYAHHSTARVLMPLHYSLVFIIGLVGNLLALVVIVQNRKKIN STTLYSMNLVISDILFTTALPTRIAYYALGFDWRIGDALCRVTALVFYINTYAGVNFMTC LSIDRFFAVVHPLRYNKIKRIEYAKGVCLSVWILVFAQTLPLLLTPMSKEEGDKTTCMEY PNFEGTASLPWILLGACLLGYVLPITVILLCYSQICCKLFRTAKQNPLTEKSGVNKKALN TIILIIVVFILCFTPYHVAIIQHMIKMLCSPGALECGARHSFQISLHFTVCLMNFNCCMD PFIYFFACKGYKRKVMKMLKRQVSVSISSAVRSAPEENSREMTESQMMIHSKASNGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TRAIP Antibody (OTI2D4) [PE/Atto594]
NBP2-74580PEATT594 0.1 mL

Mouse Monoclonal TRAIP Antibody (OTI2D4) [PE/Atto594]

Sign In for Pricing
View Details
D-2-Aminopropionic acid 99%
A27985-01 5 g

D-2-Aminopropionic acid 99%

Sign In for Pricing
View Details
D-2-Aminopropionic acid 99%
A27985-02 25 g

D-2-Aminopropionic acid 99%

Sign In for Pricing
View Details
D-2-Aminopropionic acid 99%
A27985-03 100 g

D-2-Aminopropionic acid 99%

Sign In for Pricing
View Details
Anti-Erlin-2/ERLIN2 Antibody Picoband®, Carrier-free
A07042-2-carrier-free 100 µg/Vial

Anti-Erlin-2/ERLIN2 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
EPS15 Protein Vector (Mouse) (pPM-C-His)
PV176069 500 ng

EPS15 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details