Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 183 (Gpr183)

This Recombinant Mouse G-protein coupled receptor 183 (Gpr183) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

G-protein coupled receptor 183, Epstein-Barr virus-induced G-protein coupled receptor 2, EBI2, EBV-induced G-protein coupled receptor 2

UniProt

Q3U6B2

Expression Region

1-357

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANNFTTPLATSHGNNCDLYAHHSTARVLMPLHYSLVFIIGLVGNLLALVVIVQNRKKIN STTLYSMNLVISDILFTTALPTRIAYYALGFDWRIGDALCRVTALVFYINTYAGVNFMTC LSIDRFFAVVHPLRYNKIKRIEYAKGVCLSVWILVFAQTLPLLLTPMSKEEGDKTTCMEY PNFEGTASLPWILLGACLLGYVLPITVILLCYSQICCKLFRTAKQNPLTEKSGVNKKALN TIILIIVVFILCFTPYHVAIIQHMIKMLCSPGALECGARHSFQISLHFTVCLMNFNCCMD PFIYFFACKGYKRKVMKMLKRQVSVSISSAVRSAPEENSREMTESQMMIHSKASNGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALOX5 (Phospho-Ser523) Antibody
12128-01 50 µL

ALOX5 (Phospho-Ser523) Antibody

Sign In for Pricing
View Details
ALOX5 (Phospho-Ser523) Antibody
12128-02 100 µL

ALOX5 (Phospho-Ser523) Antibody

Sign In for Pricing
View Details
TMEM150C Protein Lysate (Human) with C-Ha Tag
46915031 100 µg

TMEM150C Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D UPF0390 protein CND04920 (CND04920)
MBS1067375-01 0.05 mg (E-Coli)

Recombinant Cryptococcus neoformans var. neoformans serotype D UPF0390 protein CND04920 (CND04920)

Sign In for Pricing
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D UPF0390 protein CND04920 (CND04920)
MBS1067375-02 0.2 mg (E-Coli)

Recombinant Cryptococcus neoformans var. neoformans serotype D UPF0390 protein CND04920 (CND04920)

Sign In for Pricing
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D UPF0390 protein CND04920 (CND04920)
MBS1067375-03 0.05 mg (Yeast)

Recombinant Cryptococcus neoformans var. neoformans serotype D UPF0390 protein CND04920 (CND04920)

Sign In for Pricing
View Details