Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 183 (Gpr183)

This Recombinant Mouse G-protein coupled receptor 183 (Gpr183) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

G-protein coupled receptor 183, Epstein-Barr virus-induced G-protein coupled receptor 2, EBI2, EBV-induced G-protein coupled receptor 2

UniProt

Q3U6B2

Expression Region

1-357

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANNFTTPLATSHGNNCDLYAHHSTARVLMPLHYSLVFIIGLVGNLLALVVIVQNRKKIN STTLYSMNLVISDILFTTALPTRIAYYALGFDWRIGDALCRVTALVFYINTYAGVNFMTC LSIDRFFAVVHPLRYNKIKRIEYAKGVCLSVWILVFAQTLPLLLTPMSKEEGDKTTCMEY PNFEGTASLPWILLGACLLGYVLPITVILLCYSQICCKLFRTAKQNPLTEKSGVNKKALN TIILIIVVFILCFTPYHVAIIQHMIKMLCSPGALECGARHSFQISLHFTVCLMNFNCCMD PFIYFFACKGYKRKVMKMLKRQVSVSISSAVRSAPEENSREMTESQMMIHSKASNGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUV39H1 Rabbit Polyclonal Antibody
AF8085 50 µL

SUV39H1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NPM1P7 Protein Vector (Human) (pPM-C-HA)
PV104908 500 ng

NPM1P7 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
AKT1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-0115R-PerCP-Cy5.5 100 µL

AKT1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Xanthomonas oryzae pv. oryzae Probable ubiquinone biosynthesis protein UbiB (ubiB)
MBS7032697-01 0.02 mg

Recombinant Xanthomonas oryzae pv. oryzae Probable ubiquinone biosynthesis protein UbiB (ubiB)

Sign In for Pricing
View Details
Recombinant Xanthomonas oryzae pv. oryzae Probable ubiquinone biosynthesis protein UbiB (ubiB)
MBS7032697-02 0.1 mg

Recombinant Xanthomonas oryzae pv. oryzae Probable ubiquinone biosynthesis protein UbiB (ubiB)

Sign In for Pricing
View Details
Recombinant Xanthomonas oryzae pv. oryzae Probable ubiquinone biosynthesis protein UbiB (ubiB)
MBS7032697-03 5x 0.1 mg

Recombinant Xanthomonas oryzae pv. oryzae Probable ubiquinone biosynthesis protein UbiB (ubiB)

Sign In for Pricing
View Details