Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 183 (Gpr183)

This Recombinant Mouse G-protein coupled receptor 183 (Gpr183) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

G-protein coupled receptor 183, Epstein-Barr virus-induced G-protein coupled receptor 2, EBI2, EBV-induced G-protein coupled receptor 2

UniProt

Q3U6B2

Expression Region

1-357

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANNFTTPLATSHGNNCDLYAHHSTARVLMPLHYSLVFIIGLVGNLLALVVIVQNRKKIN STTLYSMNLVISDILFTTALPTRIAYYALGFDWRIGDALCRVTALVFYINTYAGVNFMTC LSIDRFFAVVHPLRYNKIKRIEYAKGVCLSVWILVFAQTLPLLLTPMSKEEGDKTTCMEY PNFEGTASLPWILLGACLLGYVLPITVILLCYSQICCKLFRTAKQNPLTEKSGVNKKALN TIILIIVVFILCFTPYHVAIIQHMIKMLCSPGALECGARHSFQISLHFTVCLMNFNCCMD PFIYFFACKGYKRKVMKMLKRQVSVSISSAVRSAPEENSREMTESQMMIHSKASNGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dlc1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4932807 1.0 µg DNA

Dlc1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Troponin I Protein (Active)
MBS355513-01 0.1 mg

Troponin I Protein (Active)

Sign In for Pricing
View Details
Troponin I Protein (Active)
MBS355513-02 5x 0.1 mg

Troponin I Protein (Active)

Sign In for Pricing
View Details
Bovine N1,N12-Diacetylspermine ELISA Kit
MBS7263934-01 48 Well

Bovine N1,N12-Diacetylspermine ELISA Kit

Sign In for Pricing
View Details
Bovine N1,N12-Diacetylspermine ELISA Kit
MBS7263934-02 96 Well

Bovine N1,N12-Diacetylspermine ELISA Kit

Sign In for Pricing
View Details
Bovine N1,N12-Diacetylspermine ELISA Kit
MBS7263934-03 5x 96 Well

Bovine N1,N12-Diacetylspermine ELISA Kit

Sign In for Pricing
View Details