Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken P2Y purinoceptor 8 (P2RY8)

This Recombinant Chicken P2Y purinoceptor 8 (P2RY8) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

P2Y purinoceptor 8, P2Y8

UniProt

Q5ZI82

Expression Region

1-357

Origin

Gallus gallus (Chicken)

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKNGSHLDAETLAMLQNKAISITLPVVYTMVAIISIPGNFFSLWVLCWHIKPKTPSVIF MINLSITDLLLACCFPFQIFYHIQRNHWIFGKTLCSLVTVMFYSNMYSSILTMTCISIER YMGVVYPMKLIKWRRKRYALGACVIMWIFLLLAFYPLESTDLTYEVKELGIITCFDVLKW EMLPNFAAWVAFLLTLFVVLFLIPFIVTVGCYIGTIRKLIQTSSRYGNKQKTRSIYLAII VLSVFITCFAPNNFILLAHMIVRLFYEGSLYPAYKLTLCLSCLNNCIDPFIYYFASKEFY QKFMQVFRPKVPLSDSLETRRESLFSGRTMSVRSMSSGPMDGLEGVKICLQRQESVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-500 1x 500 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF488A conjugate, 0.1mg/mL
BNC880305-500 1x 500 µL

CD95 (B-R18), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF647 conjugate, 0.1mg/mL
BNC470338-500 1x 500 µL

P53 (PAb122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCL10 (MALT-Lymphoma Marker) (151), CF488A conjugate, 0.1mg/mL
BNC881852-100 1x 100 µL

BCL10 (MALT-Lymphoma Marker) (151), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (ZL7-4), CF594 conjugate, 0.1mg/mL
BNC941627-500 1x 500 µL

CD79a (B-Cell Marker) (ZL7-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (K8/383), CF647 conjugate, 0.1mg/mL
BNC470383-100 1x 100 µL

Cytokeratin 8 (K8/383), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details