Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mustela putorius furo D (4) dopamine receptor (DRD4)

This Recombinant Mustela putorius furo D (4) dopamine receptor (DRD4) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

D (4) dopamine receptor, Dopamine D4 receptor

UniProt

Q6TLJ0

Expression Region

1-357

Origin

Mustela putorius furo (European domestic ferret) (Mustela furo)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNRSAADADGLLAGRGPGTGGGAGSPGAAAALVGGVLLIGAVLAGNALVCVSVAAERAL QTPTNYFIVSLAAADLLLALLVLPLFVYSEVQGGVWQFSPGLCDALMAMDVMLCTASIFN LCAISADRFVAVAVPLSYNRQSGGGRQLLLIGATWLLSAAVAAPVLCGLNDARGRDPAVC RLEDRDYVVYSSVCSFFLPCPVMLLLYWATFRGLRRWEAARRTKLHGRRPRRPSGPGPPP PEAVETPEAPEAIPTPDATLAEPALPASEERRAKITGRERKAMRVLPVVVGAFLVCWTPF FVVHITGALCPACAVPPRLVSAVTWLGYVNSALNPLIYTVFNAEFRAVFRKALRLCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL
BNC470050-100 1x 100 µL

IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
BNC471081-500 1x 500 µL

CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL
BNC040181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
BNC740225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF568 conjugate, 0.1mg/mL
BNC680342-100 1x 100 µL

CD43 (84-3C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PCRP-TP53-2A10), CF488A conjugate, 0.1mg/mL
BNC881924-500 1x 500 µL

P53 Tumor Suppressor Protein (PCRP-TP53-2A10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details