Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2B2 (OR2B2)

This Recombinant Human Olfactory receptor 2B2 (OR2B2) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

Olfactory receptor 2B2, Hs6M1-10, Olfactory receptor 2B9, Olfactory receptor 6-1, OR6-1

UniProt

Q9GZK3

Expression Region

1-357

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNWVNKSVPQEFILLVFSDQPWLEIPPFVMFLFSYILTIFGNLTIILVSHVDFKLHTPMY FFLSNLSLLDLCYTTSTVPQMLVNICNTRKVISYGGCVAQLFIFLALGSTECLLLAVMCF DRFVAICRPLHYSIIMHQRLCFQLAAASWISGFSNSVLQSTWTLKMPLCGHKEVDHFFCE VPALLKLSCVDTTANEAELFFISVLFLLIPVTLILISYAFIVQAVLRIQSAEGQRKAFGT CGSHLIVVSLFYGTAISMYLQPPSPSSKDRGKMVSLFCGIIAPMLNPLIYTLRNKEVKEA FKRLVAKSLLNQEIRNMQMISFAKDTVLTYLTNFSASCPIFVITIENYCNLPQRKFP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Hydroxy-1-methyl-7-phenoxy-3-isoquinolinecarboxylic acid methyl ester
JH913337 1 Each

4-Hydroxy-1-methyl-7-phenoxy-3-isoquinolinecarboxylic acid methyl ester

Sign In for Pricing
View Details
Interleukin-1 Beta (IL-1b) Human
GWB-5DB13B 0.01 mg

Interleukin-1 Beta (IL-1b) Human

Sign In for Pricing
View Details
PDZK3 Polyclonal Antibody, Cy5.5 Conjugated
bs-9037R-Cy5.5 100 µL

PDZK3 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Anti-GLP2R antibody
STJ192649 200 µl

Anti-GLP2R antibody

Sign In for Pricing
View Details
Atrial Natriuretic Peptide (eel) (ANP, Atrial Natriuretic Factor)
A4152-01 1 mg

Atrial Natriuretic Peptide (eel) (ANP, Atrial Natriuretic Factor)

Sign In for Pricing
View Details
Diethyl (3,3-diethoxyprop-1-yl) phosphonate
OR10705 1 Each

Diethyl (3,3-diethoxyprop-1-yl) phosphonate

Sign In for Pricing
View Details