Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Prostaglandin D2 receptor (Ptgdr)

This Recombinant Mouse Prostaglandin D2 receptor (Ptgdr) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

Prostaglandin D2 receptor, PGD receptor, PGD2 receptor, Prostanoid DP receptor

UniProt

P70263

Expression Region

1-357

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNESYRCQTSTWVERGSSATMGAVLFGAGLLGNLLALVLLARSGLGSCRPGPLHPPPSVF YVLVCGLTVTDLLGKCLISPMVLAAYAQNQSLKELLPASGNQLCETFAFLMSFFGLASTL QLLAMAVECWLSLGHPFFYQRHVTLRRGVLVAPVVAAFCLAFCALPFAGFGKFVQYCPGT WCFIQMIHKERSFSVIGFSVLYSSLMALLVLATVVCNLGAMYNLYDMHRRQRHYPHRCSR DRAQSGSDYRHGSLHPLEELDHFVLLALMTVLFTMCSLPLIYRAYYGAFKLENKAEGDSE DLQALRFLSVISIVDPWIFIIFRTSVFRMLFHKVFTRPLIYRNWSSHSQQSNVESTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DVL3 Knockout Raji Polyclonal Cells
ARG40120 1 Million

DVL3 Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details
CDC25B Mouse Monoclonal Antibody [Clone ID: OTI11C5]
TA812342S 30 µL

CDC25B Mouse Monoclonal Antibody [Clone ID: OTI11C5]

Sign In for Pricing
View Details
GPR146 Lentiviral Activation Particles (m)
sc-429790-LAC 200 µL

GPR146 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
TPI1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
47359124 3x 1.0µg DNA

TPI1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Human Low affinity immunoglobulin epsilon Fc receptor, FCER2 ELISA KIT
JOT-EK7572Hu-01 96 Well

Human Low affinity immunoglobulin epsilon Fc receptor, FCER2 ELISA KIT

Sign In for Pricing
View Details
Human Low affinity immunoglobulin epsilon Fc receptor, FCER2 ELISA KIT
JOT-EK7572Hu-02 48 Well

Human Low affinity immunoglobulin epsilon Fc receptor, FCER2 ELISA KIT

Sign In for Pricing
View Details