Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat 5-hydroxytryptamine receptor 5A (Htr5a)

This Recombinant Rat 5-hydroxytryptamine receptor 5A (Htr5a) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 5A, 5-HT-5A, 5-HT5A, REC17, Serotonin receptor 5A

UniProt

P35364

Expression Region

1-357

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLPINLTSFSLSTPSTLEPNRSLDTEALRTSQSFLSAFRVLVLTLLGFLAAATFTWNLL VLATILRVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSGRRWQLGRRLCQLWIAC DVLCCTASIWNVTAIALDRYWSITRHLEYTLRARKRVSNVMILLTWALSAVISLAPLLFG WGETYSELSEECQVSREPSYTVFSTVGAFYLPLCVVLFVYWKIYKAAKFRMGSRKTNSVS PIPEAVEVKDASQHPQMVFTVRHATVTFQTEGDTWREQKEQRAALMVGILIGVFVLCWFP FFVTELISPLCSWDIPALWKSIFLWLGYSNSFFNPLIYTAFNRSYSSAFKVFFSKQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Spleen
CR562327 5 µg

Tissue Total RNA, Spleen

Sign In for Pricing
View Details
Pyridoxol 5'-Phosphate >90%
TRC-P991780-10MG 10 mg

Pyridoxol 5'-Phosphate >90%

Sign In for Pricing
View Details
C16orf57 (USB1) (NM_001195302) Human Over-expression Lysate
LC434095 20 µg

C16orf57 (USB1) (NM_001195302) Human Over-expression Lysate

Sign In for Pricing
View Details
Col16a1 Mouse Gene Knockout Kit (CRISPR)
KN503620 1 Kit

Col16a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS636442 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Smtnl1 Mouse Gene Knockout Kit (CRISPR)
KN516356 1 Kit

Smtnl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details