Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat 5-hydroxytryptamine receptor 5A (Htr5a)

This Recombinant Rat 5-hydroxytryptamine receptor 5A (Htr5a) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 5A, 5-HT-5A, 5-HT5A, REC17, Serotonin receptor 5A

UniProt

P35364

Expression Region

1-357

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLPINLTSFSLSTPSTLEPNRSLDTEALRTSQSFLSAFRVLVLTLLGFLAAATFTWNLL VLATILRVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSGRRWQLGRRLCQLWIAC DVLCCTASIWNVTAIALDRYWSITRHLEYTLRARKRVSNVMILLTWALSAVISLAPLLFG WGETYSELSEECQVSREPSYTVFSTVGAFYLPLCVVLFVYWKIYKAAKFRMGSRKTNSVS PIPEAVEVKDASQHPQMVFTVRHATVTFQTEGDTWREQKEQRAALMVGILIGVFVLCWFP FFVTELISPLCSWDIPALWKSIFLWLGYSNSFFNPLIYTAFNRSYSSAFKVFFSKQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Biphenylboronic acid
TRC-B535223-250MG 250 mg

2-Biphenylboronic acid

Sign In for Pricing
View Details
MCM3 (NM_002388) Human Over-expression Lysate
LY419355 100 µg

MCM3 (NM_002388) Human Over-expression Lysate

Sign In for Pricing
View Details
IL2 Mouse Monoclonal Antibody [Clone ID: OTI5A9]
CF810802 100 µg

IL2 Mouse Monoclonal Antibody [Clone ID: OTI5A9]

Sign In for Pricing
View Details
Cyclin B2 (X29.2), CF568 conjugate, 0.1mg/mL
BNC683059-100 1x 100 µL

Cyclin B2 (X29.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ETNK2 (N-term) Rabbit Polyclonal Antibody
AP51469PU-N 400 µL

ETNK2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BRP44 (MPC2) (NM_001143674) Human Over-expression Lysate
LC428311 20 µg

BRP44 (MPC2) (NM_001143674) Human Over-expression Lysate

Sign In for Pricing
View Details