Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5-hydroxytryptamine receptor 5A (HTR5A)

This Recombinant Human 5-hydroxytryptamine receptor 5A (HTR5A) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 5A, 5-HT-5, 5-HT-5A, 5-HT5A, Serotonin receptor 5A

UniProt

P47898

Expression Region

1-357

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERF (Phospho-Thr526) Antibody
MBS8509445-01 0.1 mg

ERF (Phospho-Thr526) Antibody

Sign In for Pricing
View Details
ERF (Phospho-Thr526) Antibody
MBS8509445-02 0.1 mL (AF635)

ERF (Phospho-Thr526) Antibody

Sign In for Pricing
View Details
ERF (Phospho-Thr526) Antibody
MBS8509445-03 0.1 mL (AF610)

ERF (Phospho-Thr526) Antibody

Sign In for Pricing
View Details
ERF (Phospho-Thr526) Antibody
MBS8509445-04 0.1 mL (AF405S)

ERF (Phospho-Thr526) Antibody

Sign In for Pricing
View Details
ERF (Phospho-Thr526) Antibody
MBS8509445-05 0.1 mL (AF405L)

ERF (Phospho-Thr526) Antibody

Sign In for Pricing
View Details
ERF (Phospho-Thr526) Antibody
MBS8509445-06 0.1 mL (AF546)

ERF (Phospho-Thr526) Antibody

Sign In for Pricing
View Details