Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5-hydroxytryptamine receptor 5A (HTR5A)

This Recombinant Human 5-hydroxytryptamine receptor 5A (HTR5A) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 5A, 5-HT-5, 5-HT-5A, 5-HT5A, Serotonin receptor 5A

UniProt

P47898

Expression Region

1-357

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guanine hydrochloride
orb3145365-01 10 mg

Guanine hydrochloride

Sign In for Pricing
View Details
Guanine hydrochloride
orb3145365-02 50 mg

Guanine hydrochloride

Sign In for Pricing
View Details
TPD52L3 Protein Lysate
OCOA17072-20UG 20 µg

TPD52L3 Protein Lysate

Sign In for Pricing
View Details
ML 179
4957/10 10 mg

ML 179

Sign In for Pricing
View Details
Human HDL 2 Subfraction Human Protein
BA1089 1 mg

Human HDL 2 Subfraction Human Protein

Sign In for Pricing
View Details
Recombinant Shewanella sp. Peptide chain release factor 3 (prfC), partial
MBS1286044 Inquire

Recombinant Shewanella sp. Peptide chain release factor 3 (prfC), partial

Sign In for Pricing
View Details