Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5-hydroxytryptamine receptor 5A (HTR5A)

This Recombinant Human 5-hydroxytryptamine receptor 5A (HTR5A) spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 5A, 5-HT-5, 5-HT-5A, 5-HT5A, Serotonin receptor 5A

UniProt

P47898

Expression Region

1-357

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIN siRNA (Human)
CRH9600-01 15 nmol

NIN siRNA (Human)

Sign In for Pricing
View Details
NIN siRNA (Human)
CRH9600-02 30 nmol

NIN siRNA (Human)

Sign In for Pricing
View Details
ADRB2 Recombinant Antibody, Cy5.5 Conjugated
bsm-52880R-Cy5.5 100 µL

ADRB2 Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
HSPB11, Recombinant, Human, aa1-144, His-Tag (C1orf41, HSPCO34, IFT25, PP25)
H1834-80H 500 µg

HSPB11, Recombinant, Human, aa1-144, His-Tag (C1orf41, HSPCO34, IFT25, PP25)

Sign In for Pricing
View Details
Human CD10/Neprilysin ELISA Kit PicoKine®, Carrier-free
EK0851-carrier-free 96 Well With Removable Strips

Human CD10/Neprilysin ELISA Kit PicoKine®, Carrier-free

Sign In for Pricing
View Details
CaBP8 shRNA (h) Lentiviral Particles
sc-89449-V 200 µL

CaBP8 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details