Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Carassius auratus Red-sensitive opsin

This Recombinant Carassius auratus Red-sensitive opsin spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

Red-sensitive opsin, Red cone photoreceptor pigment

UniProt

P32313

Expression Region

1-357

Origin

Carassius auratus (Goldfish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEQWGDAIFAARRRGDETTRESMFVYTNSNNTRDPFEGPNYHIAPRWVYNLATVWMFFV VVASTFTNGLVLVATAKFKKLRHPLNWILVNLAVADLAETLLASTISVTNQFFGYFILGH PMCIFEGFTVSVCGIAGLWSLTVISWERWVVVCKPFGNVKFDAKWASAGIIFSWVWSAIW CAPPIFGWSRFWPHGLKTSCGPDVFSGSEDPGVQSYMIVLMITCCIIPLAIIILCYIAVW LAIRTVAQQQKDSESTQKAEKEVSRMVVVMIFAYCFCWGPYTFCACFAAANPGYAFHPLA AAMPAYFAKSATIYNPIIYVFMNRQFRVCIMQLFGKKVDDGSEVSTSKTEVSSVAPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r33 Mouse Gene Knockout Kit (CRISPR)
KN519045 1 Kit

Vmn1r33 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Eidd 1931
TRC-E985800-1G 1 g

Eidd 1931

Sign In for Pricing
View Details
DTHD1 Human Gene Knockout Kit (CRISPR)
KN426939 1 Kit

DTHD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Leptin Receptor (LEPR) Human Gene Knockout Kit (CRISPR)
KN418456 1 Kit

Leptin Receptor (LEPR) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C3IP1 (KLHL12) (NM_021633) Human Over-expression Lysate
LY402867 100 µg

C3IP1 (KLHL12) (NM_021633) Human Over-expression Lysate

Sign In for Pricing
View Details
Human POLR2J2 (POLR2J3) activation kit by CRISPRa
GA118618 1 Kit

Human POLR2J2 (POLR2J3) activation kit by CRISPRa

Sign In for Pricing
View Details