Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Carassius auratus Red-sensitive opsin

This Recombinant Carassius auratus Red-sensitive opsin spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

Red-sensitive opsin, Red cone photoreceptor pigment

UniProt

P32313

Expression Region

1-357

Origin

Carassius auratus (Goldfish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEQWGDAIFAARRRGDETTRESMFVYTNSNNTRDPFEGPNYHIAPRWVYNLATVWMFFV VVASTFTNGLVLVATAKFKKLRHPLNWILVNLAVADLAETLLASTISVTNQFFGYFILGH PMCIFEGFTVSVCGIAGLWSLTVISWERWVVVCKPFGNVKFDAKWASAGIIFSWVWSAIW CAPPIFGWSRFWPHGLKTSCGPDVFSGSEDPGVQSYMIVLMITCCIIPLAIIILCYIAVW LAIRTVAQQQKDSESTQKAEKEVSRMVVVMIFAYCFCWGPYTFCACFAAANPGYAFHPLA AAMPAYFAKSATIYNPIIYVFMNRQFRVCIMQLFGKKVDDGSEVSTSKTEVSSVAPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAN2 (C-term) Rabbit Polyclonal Antibody
AP53157PU-N 400 µL

PAN2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hydrobromic Acid (47-48% in aqueous solution)
TRC-H714585-250ML 250 mL

Hydrobromic Acid (47-48% in aqueous solution)

Sign In for Pricing
View Details
Serological Pipette BPIC-613
BPIC-613 1 Unit

Serological Pipette BPIC-613

Sign In for Pricing
View Details
Human RIBC1 activation kit by CRISPRa
GA115972 1 Kit

Human RIBC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Drebrin 1 (DBN1) (DBN1/2880), 0.2mg/mL
BNUB2880-100 1x 100 µL

Drebrin 1 (DBN1) (DBN1/2880), 0.2mg/mL

Sign In for Pricing
View Details
SORCS2 (NM_020777) Human Over-expression Lysate
LC432421 20 µg

SORCS2 (NM_020777) Human Over-expression Lysate

Sign In for Pricing
View Details