Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Carassius auratus Red-sensitive opsin

This Recombinant Carassius auratus Red-sensitive opsin spans the amino acid sequence from region 1-357.

Product Specifications

Product Name Alternative

Red-sensitive opsin, Red cone photoreceptor pigment

UniProt

P32313

Expression Region

1-357

Origin

Carassius auratus (Goldfish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEQWGDAIFAARRRGDETTRESMFVYTNSNNTRDPFEGPNYHIAPRWVYNLATVWMFFV VVASTFTNGLVLVATAKFKKLRHPLNWILVNLAVADLAETLLASTISVTNQFFGYFILGH PMCIFEGFTVSVCGIAGLWSLTVISWERWVVVCKPFGNVKFDAKWASAGIIFSWVWSAIW CAPPIFGWSRFWPHGLKTSCGPDVFSGSEDPGVQSYMIVLMITCCIIPLAIIILCYIAVW LAIRTVAQQQKDSESTQKAEKEVSRMVVVMIFAYCFCWGPYTFCACFAAANPGYAFHPLA AAMPAYFAKSATIYNPIIYVFMNRQFRVCIMQLFGKKVDDGSEVSTSKTEVSSVAPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PPY (Pancreatic polypeptide) ELISA kit
E-EL-H6236-01 24 Tests

Human PPY (Pancreatic polypeptide) ELISA kit

Sign In for Pricing
View Details
Human PPY (Pancreatic polypeptide) ELISA kit
E-EL-H6236-02 48 Tests

Human PPY (Pancreatic polypeptide) ELISA kit

Sign In for Pricing
View Details
Human PPY (Pancreatic polypeptide) ELISA kit
E-EL-H6236-03 96 Tests

Human PPY (Pancreatic polypeptide) ELISA kit

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1365), CF405S conjugate, 0.1mg/mL
BNC041365-100 1x 100 µL

Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1365), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SARS-CoV-2 Spike Trimer Protein, His Tag (BQ.1.1.10/Omicron) (MALS verified)
SPN-C524m-500ug 500 µg

SARS-CoV-2 Spike Trimer Protein, His Tag (BQ.1.1.10/Omicron) (MALS verified)

Sign In for Pricing
View Details
Sanguinarium Chloride
TRC-S112500-5MG 5 mg

Sanguinarium Chloride

Sign In for Pricing
View Details