Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trace amine-associated receptor 7b (Taar7b)

This Recombinant Mouse Trace amine-associated receptor 7b (Taar7b) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 7b, TaR-7b, Trace amine receptor 7b

UniProt

Q5QD11

Expression Region

1-358

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATDNDSFPWDQDSILSSDMFSATSTELCYENLNRSCVRSPYSPGPRLILYAVFGFGAAL AVCGNLLVMTSILHFRQLHSPANFLVVSLACADFLVGLTVMPFSTVRSVEGCWYFGESYC KLHTCFDVSFCYCSIFHLCFISVDRYIAVSDPLTYPTRFTAFVSGKCITFSWLLSTIYGF SLLYTGANEAGLEDLVSALTCVGGCQLAVNQSWVFINFLLFLIPTLVMITVYSKIFLIAK QQAQNIEKMSKQTARASDSYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLG FITPTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLIVSGKVLRENSSTTNLFPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DRB (HLA-DRB/1067), CF647 conjugate, 0.1mg/mL
BNC471067-100 1x 100 µL

HLA-DRB (HLA-DRB/1067), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DRG1 Rabbit Polyclonal Antibody
TA375622 100 µL

DRG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Protein Lysate, Prostate
CP815066 150 µg

Tissue Protein Lysate, Prostate

Sign In for Pricing
View Details
Annexin VIII (ANXA8) (NM_001040084) Human Over-expression Lysate
LC421668 20 µg

Annexin VIII (ANXA8) (NM_001040084) Human Over-expression Lysate

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Morniga M Lectin (black mulberry) -MNA-M-
LA-9004-1 1 mg

Alkaline Phosphatase Conjugated Morniga M Lectin (black mulberry) -MNA-M-

Sign In for Pricing
View Details
FBXO44 (NM_001014765) Human Over-expression Lysate
LC423077 20 µg

FBXO44 (NM_001014765) Human Over-expression Lysate

Sign In for Pricing
View Details