Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trace amine-associated receptor 7f (Taar7f)

This Recombinant Mouse Trace amine-associated receptor 7f (Taar7f) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 7f, TaR-7f, Trace amine receptor 7f

UniProt

Q5QD08

Expression Region

1-358

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIADETVSWNQDSILSRDLFSATSAELCYENLNRSCVRSPYSPGPRLILYAVFGFGAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGVMVMPFSMVRSVEGCWYFGDSYC KLHTCFDVSFCYCSLFHLCFISVDRYIAVSDPLAYPTRFTASVSGKCITFSWLLSISYGF SLIYTGASEAGLEDLVSSLTCVGGCQIAVNQTWVFINFSVFLIPTLVMITVYSKIFLIAK QQAQNIEKMSKQTARASDSYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSFIDAFLG FITPTYVYEILVWIVYYNSAMNPLIYAFFYPWFRKAIKLTVTGKILRENSSTTNLFSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TM Antibody
OACD07827-100UL 100 µL

TM Antibody

Sign In for Pricing
View Details
PNLIPRP2 Polyclonal Antibody
E-AB-65978-01 60 µL

PNLIPRP2 Polyclonal Antibody

Sign In for Pricing
View Details
PNLIPRP2 Polyclonal Antibody
E-AB-65978-02 120 µL

PNLIPRP2 Polyclonal Antibody

Sign In for Pricing
View Details
PNLIPRP2 Polyclonal Antibody
E-AB-65978-03 200 µL

PNLIPRP2 Polyclonal Antibody

Sign In for Pricing
View Details
Hps6 Mouse shRNA Plasmid (Locus ID 20170)
TL501953 1 Kit

Hps6 Mouse shRNA Plasmid (Locus ID 20170)

Sign In for Pricing
View Details
KRT18P17 ORF Vector (Human) (pORF)
ORF022378 1.0 µg DNA

KRT18P17 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details