Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trace amine-associated receptor 7f (Taar7f)

This Recombinant Mouse Trace amine-associated receptor 7f (Taar7f) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 7f, TaR-7f, Trace amine receptor 7f

UniProt

Q5QD08

Expression Region

1-358

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIADETVSWNQDSILSRDLFSATSAELCYENLNRSCVRSPYSPGPRLILYAVFGFGAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGVMVMPFSMVRSVEGCWYFGDSYC KLHTCFDVSFCYCSLFHLCFISVDRYIAVSDPLAYPTRFTASVSGKCITFSWLLSISYGF SLIYTGASEAGLEDLVSSLTCVGGCQIAVNQTWVFINFSVFLIPTLVMITVYSKIFLIAK QQAQNIEKMSKQTARASDSYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSFIDAFLG FITPTYVYEILVWIVYYNSAMNPLIYAFFYPWFRKAIKLTVTGKILRENSSTTNLFSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPN3 Antibody
C43972-01 50 µL

GPN3 Antibody

Sign In for Pricing
View Details
GPN3 Antibody
C43972-02 100 µL

GPN3 Antibody

Sign In for Pricing
View Details
SIN3B Protein Vector (Mouse) (pPB-N-His)
PV229219 500 ng

SIN3B Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Aprt (NM_009698) AAV Particle
MR201601A1V 250 µL

Mouse Aprt (NM_009698) AAV Particle

Sign In for Pricing
View Details
Rabbit Polyclonal Cyclophilin-E Antibody [DyLight 755]
NBP2-99016IR 0.1 mL

Rabbit Polyclonal Cyclophilin-E Antibody [DyLight 755]

Sign In for Pricing
View Details
ANGPTL2 (22-493, His-tag) Human Protein
AR51796PU-S 50 µg

ANGPTL2 (22-493, His-tag) Human Protein

Sign In for Pricing
View Details