Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 7c (Taar7c)

This Recombinant Rat Trace amine-associated receptor 7c (Taar7c) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 7c, TaR-7c, Trace amine receptor 7c

UniProt

Q5QD21

Expression Region

1-358

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATDDDSFPWDQDSILSRDLLSASSLQLCYENLNRSCVRSPYSPGSRLILYAVFGFGAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADLLVGLTVMPFSMVRSVEGCWYFGNTYC KFHSCFEGSFCYSSLFHLCFISLDRYIAVSDPLIYPTRFTASISGKCITFSWLLSIIYSF SLLYTGANEAGLEDLVSALTCVGGCQVAVNQSWVFINFLLFLVPALVMMTVYSKIFLIAK QQAQNIEKMSKQTARASESYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLG FITPTYMYEILVWIVYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRENSSTINLFPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BNC2 activation kit by CRISPRa
GA110265 1 Kit

Human BNC2 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human CD157/BST1 Protein (Fc Tag)
PKSH033775-01 10 µg

Recombinant Human CD157/BST1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CD157/BST1 Protein (Fc Tag)
PKSH033775-02 50 µg

Recombinant Human CD157/BST1 Protein (Fc Tag)

Sign In for Pricing
View Details
IHO1 Mouse Monoclonal Antibody [Clone ID: OTI2D11]
CF808387 100 µg

IHO1 Mouse Monoclonal Antibody [Clone ID: OTI2D11]

Sign In for Pricing
View Details
HNF6 (ONECUT1) Rabbit Polyclonal Antibody
TA368508 100 µL

HNF6 (ONECUT1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SRC Mouse Monoclonal Antibody [Clone ID: 5D10C4]
AM06238SU-N 100 µL

SRC Mouse Monoclonal Antibody [Clone ID: 5D10C4]

Sign In for Pricing
View Details