Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 7c (Taar7c)

This Recombinant Rat Trace amine-associated receptor 7c (Taar7c) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 7c, TaR-7c, Trace amine receptor 7c

UniProt

Q5QD21

Expression Region

1-358

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATDDDSFPWDQDSILSRDLLSASSLQLCYENLNRSCVRSPYSPGSRLILYAVFGFGAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADLLVGLTVMPFSMVRSVEGCWYFGNTYC KFHSCFEGSFCYSSLFHLCFISLDRYIAVSDPLIYPTRFTASISGKCITFSWLLSIIYSF SLLYTGANEAGLEDLVSALTCVGGCQVAVNQSWVFINFLLFLVPALVMMTVYSKIFLIAK QQAQNIEKMSKQTARASESYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLG FITPTYMYEILVWIVYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRENSSTINLFPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSH3BP1 (ABI1) (NM_005470) Human Over-expression Lysate
LY401677 100 µg

SSH3BP1 (ABI1) (NM_005470) Human Over-expression Lysate

Sign In for Pricing
View Details
Ep-CAM / CD326 (Cocktail PAN-EpCAM), CF405S conjugate, 0.1mg/mL
BNC040969-500 1x 500 µL

Ep-CAM / CD326 (Cocktail PAN-EpCAM), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RRH Antibody
8G496-AAT 50 µg

RRH Antibody

Sign In for Pricing
View Details
Cytokeratin 14 Recombinant Mouse Monoclonal Antibody [A2C11-R]
HA601259 100 µL

Cytokeratin 14 Recombinant Mouse Monoclonal Antibody [A2C11-R]

Sign In for Pricing
View Details
SAR1 (SAR1A) (NM_001142648) Human Over-expression Lysate
LY428231 100 µg

SAR1 (SAR1A) (NM_001142648) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant CTSO Antibody (Biotin)
RB-14454-01 50 μL

Recombinant CTSO Antibody (Biotin)

Sign In for Pricing
View Details