Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 7c (Taar7c)

This Recombinant Rat Trace amine-associated receptor 7c (Taar7c) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 7c, TaR-7c, Trace amine receptor 7c

UniProt

Q5QD21

Expression Region

1-358

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATDDDSFPWDQDSILSRDLLSASSLQLCYENLNRSCVRSPYSPGSRLILYAVFGFGAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADLLVGLTVMPFSMVRSVEGCWYFGNTYC KFHSCFEGSFCYSSLFHLCFISLDRYIAVSDPLIYPTRFTASISGKCITFSWLLSIIYSF SLLYTGANEAGLEDLVSALTCVGGCQVAVNQSWVFINFLLFLVPALVMMTVYSKIFLIAK QQAQNIEKMSKQTARASESYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLG FITPTYMYEILVWIVYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRENSSTINLFPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker), 0.2mg/mL
BNUB1645-500 1x 500 µL

Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker), 0.2mg/mL

Sign In for Pricing
View Details
EIF2B3 (NM_001166588) Human Over-expression Lysate
LY433030 100 µg

EIF2B3 (NM_001166588) Human Over-expression Lysate

Sign In for Pricing
View Details
CX3CL1 Human Gene Knockout Kit (CRISPR)
KN200420 1 Kit

CX3CL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Presenilin 1 / PS-1 Rabbit polyclonal Antibody
ER1915-40 100 µL

Presenilin 1 / PS-1 Rabbit polyclonal Antibody

Sign In for Pricing
View Details
PCYT1A (NM_005017) Human Recombinant Protein
TP308130M 100 µg

PCYT1A (NM_005017) Human Recombinant Protein

Sign In for Pricing
View Details
CELA1 (NM_001971) Human Over-expression Lysate
LC419617 20 µg

CELA1 (NM_001971) Human Over-expression Lysate

Sign In for Pricing
View Details