Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trace amine-associated receptor 7a (Taar7a)

This Recombinant Mouse Trace amine-associated receptor 7a (Taar7a) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 7a, TaR-7a, Trace amine receptor 7a

UniProt

Q5QD12

Expression Region

1-358

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKLVDHFLSDQSRTMNEDLFSATSTELCYENLNRSCVRSPYSPGPRLILYAVFGFGAAL AVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFSTVRSVEGCWYFGESYC KFHSCFEGSFCYSSIFHLCFISVDRYIAVSDPLTYPTRFTASVSGKCITFSWLLSIIYSF SLLYTGANEAGLEDLVSVLTCVGGCQIAVNQSWVFINFLLFLIPTLVMMTVYSKIFLIAK QQAQNIEKMSKQTARASESYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLG FITPTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRENSSTTNLFPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

a Mouse Gene Knockout Kit (CRISPR)
KN500536 1 Kit

a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DUSP6 Rabbit Polyclonal Antibody
AP15265PU-N 400 µL

DUSP6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Chlorobenzaldehyde Oxime
TRC-C364665-25G 25 g

2-Chlorobenzaldehyde Oxime

Sign In for Pricing
View Details
JNK1 (MAPK8) (Thr183/Tyr185) Rabbit Polyclonal Antibody
AP52605PU-N 400 µL

JNK1 (MAPK8) (Thr183/Tyr185) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
THBS4 Antibody (Biotin)
KB-8212-01 50 μL

THBS4 Antibody (Biotin)

Sign In for Pricing
View Details
THBS4 Antibody (Biotin)
KB-8212-02 100 µL

THBS4 Antibody (Biotin)

Sign In for Pricing
View Details