Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Trace amine-associated receptor 7a (Taar7a)

This Recombinant Mouse Trace amine-associated receptor 7a (Taar7a) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 7a, TaR-7a, Trace amine receptor 7a

UniProt

Q5QD12

Expression Region

1-358

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKLVDHFLSDQSRTMNEDLFSATSTELCYENLNRSCVRSPYSPGPRLILYAVFGFGAAL AVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFSTVRSVEGCWYFGESYC KFHSCFEGSFCYSSIFHLCFISVDRYIAVSDPLTYPTRFTASVSGKCITFSWLLSIIYSF SLLYTGANEAGLEDLVSVLTCVGGCQIAVNQSWVFINFLLFLIPTLVMMTVYSKIFLIAK QQAQNIEKMSKQTARASESYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLG FITPTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRENSSTTNLFPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prohibitin (Mitochondrial Marker) (PHB/3229), CF405S conjugate, 0.1mg/mL
BNC043229-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/3229), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SLU7 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7C8]
TA810917AM 100 µL

SLU7 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7C8]

Sign In for Pricing
View Details
PSMD7 Recombinant Rabbit Monoclonal Antibody [PSH01-83]
HA721735 100 µL

PSMD7 Recombinant Rabbit Monoclonal Antibody [PSH01-83]

Sign In for Pricing
View Details
Naphthol AS-LC
TRC-N234400-5G 5 g

Naphthol AS-LC

Sign In for Pricing
View Details
Recombinant Human BCMA/TNFRSF17 Protein (Fc Tag)
PKSH033752-01 10 µg

Recombinant Human BCMA/TNFRSF17 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human BCMA/TNFRSF17 Protein (Fc Tag)
PKSH033752-02 50 µg

Recombinant Human BCMA/TNFRSF17 Protein (Fc Tag)

Sign In for Pricing
View Details