Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neurospora crassa Chitin synthase export chaperone (chs-7)

This Recombinant Neurospora crassa Chitin synthase export chaperone (chs-7) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Chitin synthase export chaperone

UniProt

Q7SB92

Expression Region

1-358

Origin

Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKFGDFSSICRMAPIPLCASVGPITSIATGVGIEPDCYARNIEVANTIIFQGAASVMHI VALVMTVVMLLHVRGKFTAVGRKEITTFFYLYMILTFLSLCIDAGVIPPHSGSYPYFVAV QAGLASALVTCLVINGFVGFQLYEDGTPLSLWMLRLCSFVAFVISFLVGLATFKSWAGLG PTNTVGIFVVLYFLNALQLLLYVVMQIILVTRTLQDRWPLGDIAFGLFFFIAGQVILYAF SSPICEGISHYLDGLFFATTCNLLAVMMVYKYWDSITKEDLEFSVGTRMNNWEVKELLPQ GPEEDRRATVYADPIYEGHYASGPGTGSGASASGYEGGHHRRESHGYTPSPNRQSLRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse DEFa4 protein, N-His-GST Tag
IMP-3793 10 µg

Recombinant Mouse DEFa4 protein, N-His-GST Tag

Sign In for Pricing
View Details
OLFML3 (NM_020190) Human Over-expression Lysate
LS056944-100ug 100 µg

OLFML3 (NM_020190) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral mouse Gem shRNA (UAS) - Lentiviral mouse Gem shRNA (UAS, GFP) (100)
GTR15258129 1 Vial

Lentiviral mouse Gem shRNA (UAS) - Lentiviral mouse Gem shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Mouse Monoclonal Hepatocyte Specific Antigen Antibody (HSA133) [DyLight 488]
NBP2-34644G 0.1 mL

Mouse Monoclonal Hepatocyte Specific Antigen Antibody (HSA133) [DyLight 488]

Sign In for Pricing
View Details
ING2/ING1L Antibody
orb18385 100 µg

ING2/ING1L Antibody

Sign In for Pricing
View Details
NDC80 Antibody
CSB-PA215188 100 µL

NDC80 Antibody

Sign In for Pricing
View Details