Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neurospora crassa Chitin synthase export chaperone (chs-7)

This Recombinant Neurospora crassa Chitin synthase export chaperone (chs-7) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Chitin synthase export chaperone

UniProt

Q7SB92

Expression Region

1-358

Origin

Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKFGDFSSICRMAPIPLCASVGPITSIATGVGIEPDCYARNIEVANTIIFQGAASVMHI VALVMTVVMLLHVRGKFTAVGRKEITTFFYLYMILTFLSLCIDAGVIPPHSGSYPYFVAV QAGLASALVTCLVINGFVGFQLYEDGTPLSLWMLRLCSFVAFVISFLVGLATFKSWAGLG PTNTVGIFVVLYFLNALQLLLYVVMQIILVTRTLQDRWPLGDIAFGLFFFIAGQVILYAF SSPICEGISHYLDGLFFATTCNLLAVMMVYKYWDSITKEDLEFSVGTRMNNWEVKELLPQ GPEEDRRATVYADPIYEGHYASGPGTGSGASASGYEGGHHRRESHGYTPSPNRQSLRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Hydroxy-3,4,7-triphenyl-2,6-benzofurandione
HY-N14414 1 Each

5-Hydroxy-3,4,7-triphenyl-2,6-benzofurandione

Sign In for Pricing
View Details
Magic™ Membrane Protein Human SSC4D (Scavenger receptor cysteine rich family member with 4 domains) for Antibody Discovery
MP1291X Each

Magic™ Membrane Protein Human SSC4D (Scavenger receptor cysteine rich family member with 4 domains) for Antibody Discovery

Sign In for Pricing
View Details
Trim32 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3452708 1.0 µg DNA

Trim32 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
PTH Antibody : Biotin (OAAF01895-Biotin)
OAAF01895-100UG-Biotin 100 µg

PTH Antibody : Biotin (OAAF01895-Biotin)

Sign In for Pricing
View Details
BCL2L11 (Center) Rabbit pAb
E2620597 100 µL

BCL2L11 (Center) Rabbit pAb

Sign In for Pricing
View Details
High Sensitive Northern Blot Probes : miR-31-5p (HS)
HP-0035 1 Each

High Sensitive Northern Blot Probes : miR-31-5p (HS)

Sign In for Pricing
View Details